Protein coding transcript 192274

• Transcript: Ll_transcript_67166
• CDS coordinates: 59-529 (+)
• Peptide sequence: MASSFVFGIAISIVVLGLCCSAGFAQQQIRAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTHRPTGRFSNGLNIPDLISLELGLEPTLPYLSPLLVGEKLLVGANFASAGIGILNDTGFQFLHIIHIQKQFKLFQDYQKRLSAHIGAEGAKRV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_67166

• Blastp: GDSL esterase/lipase At4g28780 from Arabidopsis with 73.44% of identity
• Blastx: GDSL esterase/lipase At4g28780 from Arabidopsis with 73.44% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT4G28780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432857.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;