Protein coding transcript 192279

• Transcript: Ll_transcript_67164
• CDS coordinates: 2-658 (+)
• Peptide sequence: THKYKAMGSCYVFSVAISIVVVLALSSSAASAQQHTRAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDLISLDLGLEPTLPYLSPLLVGEKLLVGANFASAGIGILNDTGFQFMHIIHIYKQLKLFQHYQLRLCAHIGKEAAKKHINNALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVHYLISEYRPILKVLFSQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_67164

• Blastp: GDSL esterase/lipase LTL1 from Arabidopsis with 73.51% of identity
• Blastx: GDSL esterase/lipase At5g33370 from Arabidopsis with 76.83% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT3G04290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418998.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;