Protein coding transcript 192280

• Transcript: Ll_transcript_67190
• CDS coordinates: 186-824 (+)
• Peptide sequence: MGTSSLVFGYCIIIITSLFMAVVFGSNIPTRAFFVFGDSLVDSGNNVFLATSARADAPPYGIDFPTHRPTGRFSNGLNIPDLISEQLGFEPTLPYLSPVLVGEKLLVGANFASAGIGILNDTGFQFMHIIHIYKQLKLFQHYQLRLCAHIGKEAAKKHINNALVLITLGGNDFVNNYYLVPYSARSRQFSLPDYVHYLISEYRPILKVLFSQ*
• ORF Type: complete

Annotations of Ll_transcript_67190

• Blastp: GDSL esterase/lipase At5g33370 from Arabidopsis with 66.34% of identity
• Blastx: GDSL esterase/lipase At5g33370 from Arabidopsis with 75.61% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT5G33370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428458.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;