| Transcript | Ll_transcript_67181 |
|---|---|
| CDS coordinates | 2-394 (+) |
| Peptide sequence | THKYKAMGSCYVFSVAISIVVVLALSSSAASAQQHTRAFFVFGDSLVDSGNNDFLATTARADAPPYGIDYPTRRPTGRFSNGLNIPDLISLDLGLEPTLPYLSPLLVGEKLLVCANFASAGIGILNDTGFQ |
| ORF Type | internal |
| Blastp | GDSL esterase/lipase At4g28780 from Arabidopsis with 69.17% of identity |
|---|---|
| Blastx | GDSL esterase/lipase At4g28780 from Arabidopsis with 82.11% of identity |
| Eggnog | GDSL esterase lipase(COG3240) |
| Kegg | Link to kegg annotations (AT4G28780) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418998.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer