Protein coding transcript 192317

• Transcript: Ll_transcript_68907
• CDS coordinates: 1-597 (+)
• Peptide sequence: LRSSEQCKCKWKNLVTRYKGCETMEPESMRHQFPFYNELQAIFTARIQQMLWSEASEGVSKKKTMQLSSEDEEYVNEESEGDHNNIKGTSRKKKKGKMVTGGGSNNSKGLKEILEEFMRQQMQMEVQWMEAFEAKENERKLKEIEWRKAMEALENERVMNDQRWREREEQRRMREETRAENRDTLITILLNKLTREEI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_68907

• Blastp: Trihelix transcription factor GT-3a from Arabidopsis with 50.45% of identity
• Blastx: Trihelix transcription factor GT-3a from Arabidopsis with 49.09% of identity
• Eggnog: Transcription factor(ENOG410YYXY)
• Kegg: Link to kegg annotations (AT5G01380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450758.1)
• Pfam: Myb/SANT-like DNA-binding domain (PF13837.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;