Protein coding transcript 192360

• Transcript: Ll_transcript_67829
• CDS coordinates: 1693-2010 (+)
• Peptide sequence: MVGPEYARYCGIEALEPLGIYLPGDINYPGGALFDPLNLSKDPEAFEELKVKEIKNGRLAMAAWLGFSVQAALTGKGPVQNLVEHISDPFHNNLLSSLNFMKVVL*
• ORF Type: complete

Annotations of Ll_transcript_67829

• Blastp: Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 84.85% of identity
• Blastx: Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 71.33% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410YIPW)
• Kegg: Link to kegg annotations (AT1G76570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020202935.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;