Protein coding transcript 192382

• Transcript: Ll_transcript_67866
• CDS coordinates: 110-616 (+)
• Peptide sequence: MASIHPQLSPLSFSSSLLTTSFHFPSSLSVSHPHRLSFSCNASWQELAGVLVFSAIPFTVVKAIANSPLGESLQKRMEQTKKFALQNSAKFKALAEKARKESFWYGEDRPRWLGPISYDYPSYLTGELPGDYGFDIAGLAKDPVALQKYLKYVIVLIFPHVFIAACQI*
• ORF Type: complete

Annotations of Ll_transcript_67866

• Blastp: Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 67.24% of identity
• Blastx: Chlorophyll a-b binding protein 7, chloroplastic from Arabidopsis with 67.24% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410YIPW)
• Kegg: Link to kegg annotations (AT1G76570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449531.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;