Protein coding transcript 192395

• Transcript: Ll_transcript_67848
• CDS coordinates: 148-906 (+)
• Peptide sequence: MACHCVSSYNAFLFSPTKQFFTINSITMSNSTTKCRPFFLSSITNASPSYNTSFVSEAVRLLVPPARFDASKLKVVQLEDQIIKHPSIIPRTYILSHCDLTANLTLTVSNVINLEQLRGWYEKDDVVAEWKKVKNEMCLHVHCFVSGPNPFMDLAAEFRYNIFSKEMPLVLEAIQYGDSTLFNEHPELLDSTVQVYFHSSSKKYNRMECWGPLKDAIEGKQDQLQVLRRRDCPPEKWWSPKSMFQALFAFLL*
• ORF Type: complete

Annotations of Ll_transcript_67848

• Blastp: Protein STAY-GREEN LIKE, chloroplastic from Arabidopsis with 60.19% of identity
• Blastx: Protein STAY-GREEN LIKE, chloroplastic from Arabidopsis with 60.19% of identity
• Eggnog: Senescence-inducible chloroplast stay-green protein(ENOG4111UAI)
• Kegg: Link to kegg annotations (AT1G44000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020222110.1)
• Pfam: Staygreen protein (PF12638.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;