Protein coding transcript 192416

• Transcript: Ll_transcript_68119
• CDS coordinates: 2273-2827 (+)
• Peptide sequence: MLGKKVLDRGGNVEEPKPWRFAESSSLIEFDTYRASERFPCPPLSNIPEIAQETIGAYEIVRKGVTRLMKKYTVKACGYCSEVHVGPWGHNVKLCGSFKHQWRDGKHGWQDATVREVFPPNHVWHVRDPSGPPLRNKLKTFYGKAPAVIEVCMQAGAQIIPDVYKPMMRLDIVIPDSEEARMIA*
• ORF Type: complete

Annotations of Ll_transcript_68119

• Blastp: APO protein 1, chloroplastic from Arabidopsis with 66.13% of identity
• Blastx: APO protein 1, chloroplastic from Arabidopsis with 67.49% of identity
• Eggnog: APO protein(ENOG410XP6U)
• Kegg: Link to kegg annotations (AT1G64810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414110.1)
• Pfam: APO RNA-binding (PF05634.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;