Protein coding transcript 192421

• Transcript: Ll_transcript_68134
• CDS coordinates: 1447-1923 (+)
• Peptide sequence: MNFYIRYLKQQACLANRSLSDYHFFNTFFYKKLKEAVSNKQSDRERFFVKFRRWWKGVNIFQKPYILIPIHEDLHWSLIIICIPDKEDESGPIILHLDSLGLHSSKSVFNNIKSYLLDEKNYLDKECLSSDVPIAEKIWNWLPRRIDTQSIAVPQQKNE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_68134

• Blastp: Ubiquitin-like-specific protease 1D from Arabidopsis with 61.64% of identity
• Blastx: Ubiquitin-like-specific protease 1D from Arabidopsis with 60.96% of identity
• Eggnog: SUMO1 sentrin specific peptidase(COG5160)
• Kegg: Link to kegg annotations (AT1G60220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421770.1)
• Pfam: Ulp1 protease family, C-terminal catalytic domain (PF02902.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;