Transcript | Ll_transcript_68143 |
---|---|
CDS coordinates | 1744-2277 (+) |
Peptide sequence | MMFHAFSLHWSLIIICIPDKEDESGPIILHLDSLGLHSSKSVFNNIKSYLLDEKNYLDKECLSSDVPIAEKIWNWLPRRIDTQSIAVPQQKNESDCGLFVLYFIQRFIEEAPERLKKKDLDMFGKRWFRPEEASSLRVKIRKLLLAELRNTVSESSSLAASANPAIEECVVPANDSS* |
ORF Type | complete |
Blastp | Ubiquitin-like-specific protease 1D from Arabidopsis with 64.79% of identity |
---|---|
Blastx | Ubiquitin-like-specific protease 1D from Arabidopsis with 64.79% of identity |
Eggnog | SUMO1 sentrin specific peptidase(COG5160) |
Kegg | Link to kegg annotations (AT1G60220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421770.1) |
Pfam | Ulp1 protease family, C-terminal catalytic domain (PF02902.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer