Protein coding transcript 192427

• Transcript: Ll_transcript_68132
• CDS coordinates: 3-308 (+)
• Peptide sequence: AYSQHSIGKYLFRKDVSQATQSDGLKSRKGQPIVLDDDDDEGPNIPEKIEEENKLPEYLKEAKIYYPTRDDPECVEVCYNDIDCLAPEGYLTSTIMNFYIR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_68132

• Blastp: Ubiquitin-like-specific protease 1D from Arabidopsis with 41.94% of identity
• Blastx: Ubiquitin-like-specific protease 1D from Arabidopsis with 41.94% of identity
• Eggnog: SUMO1 sentrin specific peptidase(COG5160)
• Kegg: Link to kegg annotations (AT1G60220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421771.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;