Protein coding transcript 192451

• Transcript: Ll_transcript_69174
• CDS coordinates: 101-811 (+)
• Peptide sequence: MAGASFYTSCLFSPSNLGTSSSVLKTHNARAAAPWKLPQRRRFRIKAEVEYVNAEQAKDLVAVEGYTVLDVRDRIQFERAHIKSSYHVPLFIENKDNDPGTILKRTLHNNFSGLFYGLPFTKPNPDFVQSVKSQFQPESKILVVCQEGLRSAAAASKLEQAGFSDVKSITSGLQKVKSGTFESVGSTELQNAGKAGLVTIQGKISAVLGTVLICAYLFITFFPDQAEKLFQLVPTS*
• ORF Type: complete

Annotations of Ll_transcript_69174

• Blastp: Rhodanese-like domain-containing protein 9, chloroplastic from Arabidopsis with 73.23% of identity
• Blastx: Rhodanese-like domain-containing protein 9, chloroplastic from Arabidopsis with 73.23% of identity
• Eggnog: Rhodanese-like domain(ENOG4111KQZ)
• Kegg: Link to kegg annotations (AT2G42220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417987.1)
• Pfam: Rhodanese-like domain (PF00581.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;