Protein coding transcript 19249

• Transcript: Ll_transcript_417585
• CDS coordinates: 140-712 (+)
• Peptide sequence: MLLEPYNQTDHPDCKSRPDSGLSGITELDPGYITGPLSSVWKEWIKWCIEFGIEANAIIAVPYDWRLAPSMLEERDLYFHRLKLTFETAFKLRGGPSLVFAHSLGNNVFRYFLEWLKLEIAPKHYIQWLDQHIHAYFAVGAPLLGATETIEATLSGFTFGLPISEVSGNSSINVQLFWFIIMDDALFQVL*
• ORF Type: complete

Annotations of Ll_transcript_417585

• Blastp: Phospholipid--sterol O-acyltransferase from Arabidopsis with 84.85% of identity
• Blastx: Phospholipid--sterol O-acyltransferase from Arabidopsis with 85.23% of identity
• Eggnog: Acyl-transferase(ENOG410Y9CF)
• Kegg: Link to kegg annotations (AT1G04010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456704.1)
• Pfam: Lecithin:cholesterol acyltransferase (PF02450.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;