Protein coding transcript 192562

• Transcript: Ll_transcript_67593
• CDS coordinates: 3575-4105 (+)
• Peptide sequence: MRELLKGISKSLGLEENFIHERMNVESGSQLLVINFYPACPNPELVMGLPAHTDHGLLTLLTQNELGGLQIQHNGHWIPVNPLPNSFLINTGDHLEILTNGKIKSVIHRVLVNNKGARISVATAQGPPLEAVVSPAPELVDDDNPAAYGAITYRDYLKIQKSNELDGKSCLDRIRI*
• ORF Type: complete

Annotations of Ll_transcript_67593

• Blastp: Protein DMR6-LIKE OXYGENASE 2 from Arabidopsis with 43.1% of identity
• Blastx: Protein DMR6-LIKE OXYGENASE 2 from Arabidopsis with 43.24% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT4G10490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459248.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;