Protein coding transcript 192565

• Transcript: Ll_transcript_67597
• CDS coordinates: 340-1116 (+)
• Peptide sequence: MFSVKGLVESNDLRSVPSKYIWPTNPEDHILHKTENVPIIDFAQLISSNPSEQSMAVQKLGDACRDWGFFMLINHGMPETLRSEFLRASQSFFDLSEEEKKEYAEGNILDPINCGTSFNVTVDKKLFWRDYLKCLVHPQFQAPSKPLGFSETSEEYVTKCRELMRELLKGISKSLGLEENFIHERMNVESGSQLLVINFYPACPNPELVMGLPAHTDHGLLTLLTQNELGGLQIQHNGHWIPVNPLPNSFLINTGDHLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_67597

• Blastp: Protein DMR6-LIKE OXYGENASE 2 from Arabidopsis with 36.25% of identity
• Blastx: Protein DMR6-LIKE OXYGENASE 2 from Arabidopsis with 36.25% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT4G10490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459248.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;