Protein coding transcript 192567

• Transcript: Ll_transcript_67600
• CDS coordinates: 340-807 (+)
• Peptide sequence: MFSVKGLVESNDLRSVPSKYIWPTNPEDHILHKTENVPIIDFAQLISSNPSEQSMAVQKLGDACRDWGFFMLINHGMPETLRSEFLRASQSFFDLSEEEKKEYAEGNILDPINCGTSFNVTVDKKLFWRDYLKCLVHPQFQAPSKPLGFRVWDRV*
• ORF Type: complete

Annotations of Ll_transcript_67600

• Blastp: Feruloyl CoA ortho-hydroxylase 1 from Arabidopsis with 34.25% of identity
• Blastx: Feruloyl CoA ortho-hydroxylase 1 from Arabidopsis with 34.25% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT3G13610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459248.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;