Transcript | Ll_transcript_68639 |
---|---|
CDS coordinates | 3-368 (+) |
Peptide sequence | KQTISYMAERVVGTGSFGVVFQAKCLETGEAVAIKKVLQDRRYKNRELQLMRMMDHPNVISLKHCFFSTTSTDELFLNLVMEYVPESMYRVLKFYTNANQRMPLIYVKLYMYQVHLRLSSD* |
ORF Type | 5prime_partial |
Blastp | Shaggy-related protein kinase GSK2 from Oryza sativa with 90.35% of identity |
---|---|
Blastx | Shaggy-related protein kinase eta from Arabidopsis with 89.27% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (4338079) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001343198.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer