| Transcript | Ll_transcript_68641 |
|---|---|
| CDS coordinates | 997-1335 (+) |
| Peptide sequence | MNPNYNDFRFPQVKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELRQPNARLPNGRPFPPLFNFKQLSGASPELINKLIPDHMKQQMGLQLAHLSGT* |
| ORF Type | complete |
| Blastp | Shaggy-related protein kinase eta from Arabidopsis with 84.07% of identity |
|---|---|
| Blastx | Shaggy-related protein kinase eta from Arabidopsis with 82.58% of identity |
| Eggnog | Serine Threonine protein kinase(COG0515) |
| Kegg | Link to kegg annotations (AT4G18710) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (NP_001343198.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer