Transcript | Ll_transcript_432272 |
---|---|
CDS coordinates | 113-529 (+) |
Peptide sequence | MGSVKLVTRASPCSVINPHYPEIRFKSQIFNPNPNPLLRVPISLKGGKTITKPFSFTVSSSLTNQNTVTVEDAEKKTTFNFKAYVLEKGDIINKALDAAIPLKEPVTIQEAMRYSLLAGGKRVRPMLCIAACELVSGRH |
ORF Type | 3prime_partial |
Blastp | Geranylgeranyl pyrophosphate synthase, chloroplastic from Capsicum with 60.67% of identity |
---|---|
Blastx | Geranylgeranyl pyrophosphate synthase, chloroplastic from Capsicum with 60.67% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107867046) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424374.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer