Transcript | Ll_transcript_66971 |
---|---|
CDS coordinates | 244-687 (+) |
Peptide sequence | MGKDLSDDQISSMKEAFTLFDSDGDGKIAPSELGILMRSLGGNPTQAQLKAIVAEENLTAPFDFPRFLDLMSKHMKLEPFDRQLRDAFKVLDKESTGFVSVTELRHILTSIGEKLEPAEFDEWIREIDVGSDGKIRYEDFIARMVAK* |
ORF Type | complete |
Blastp | Probable calcium-binding protein CML13 from Arabidopsis with 86.49% of identity |
---|---|
Blastx | Probable calcium-binding protein CML13 from Arabidopsis with 86.49% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (AT1G12310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445084.1) |
Pfam | EF hand (PF00036.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer