Transcript | Ll_transcript_417575 |
---|---|
CDS coordinates | 3-563 (+) |
Peptide sequence | GTARLMFNSFGSSLWMMPFSKYCRADDKYWKHFSAEKHIGHHTYRCDERELQSNFSGWPTNVINIEIPTTREVTPANLSSMECGMPTQLSFTAREISDGSFFKAIEDYDPDSKRLLYQLEKSYLGDPILNPLTPWDRPPIKNVFCIYGTDSKTKVGYYFAPSGKPYPDNWIITDVVYELEGSLMSR* |
ORF Type | 5prime_partial |
Blastp | Phospholipid--sterol O-acyltransferase from Arabidopsis with 68.25% of identity |
---|---|
Blastx | Phospholipid--sterol O-acyltransferase from Arabidopsis with 68.25% of identity |
Eggnog | Acyl-transferase(ENOG410Y9CF) |
Kegg | Link to kegg annotations (AT1G04010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456706.1) |
Pfam | Lecithin:cholesterol acyltransferase (PF02450.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer