Protein coding transcript 192672

• Transcript: Ll_transcript_69576
• CDS coordinates: 115-840 (+)
• Peptide sequence: MANKSLDFFLFDSDQSKLLKWPTRFYIICGIARGLLYLHQDSRLRIIHRDLKASNILLDNEMNPKISDFGLARMCGGDQIEGKTSRVVGTYGYMSPEYAYDGLFSIKSDVFSFGILLLEIVSGKKNNGLSIPDHSLNLIGHAWRLWKDGMAMQLIDDCLNESCVHFEALRCIHIGLLCVQHQPNDRPDMASVVTMLNSECLLPQPKEPSFLIKRTPIKDHYVQYHTWCSTNEVTISILSAR*
• ORF Type: complete

Annotations of Ll_transcript_69576

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 from Arabidopsis with 57.96% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 from Arabidopsis with 59.01% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G03230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449118.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;