Protein coding transcript 192674

• Transcript: Ll_transcript_69587
• CDS coordinates: 473-919 (+)
• Peptide sequence: MSPEYAYDGLFSIKSDVFSFGILLLEIVSGKKNNGLSIPDHSLNLIGHAWRLWKDGMAMQLIDDCLNESCVHFEALRCIHIGLLCVQHQPNDRPDMASVVTMLNSECLLPQPKEPSFLIKRTPIKDHYVQYHTWCSTNEVTISILSAR*
• ORF Type: complete

Annotations of Ll_transcript_69587

• Blastp: Receptor-like serine/threonine-protein kinase SD1-7 from Arabidopsis with 50% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 from Arabidopsis with 69.53% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G65790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449118.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;