Protein coding transcript 192696

• Transcript: Ll_transcript_68000
• CDS coordinates: 536-1243 (+)
• Peptide sequence: MHMRGHGDEYKTPAALAKPHKESGSEPKLIKRYSCPYAGCKRNKDHKKFQPLKTILCVKNHYKRTHCDKSYICSRCNTKRFSVLADLKTHEKHCGKDKWLCSCGTTFSRKDKLFGHMALFQGHTPAIPFDDTKGGPGGALDLDIKENNSKVGSMNFCFGSNSSSENGVQNMDVKGNIDDPTNYFSPLNFEGCNFGGFNEFSQPAFEDSEGSFSFLMSGSFNYAPKIAGETNSENL*
• ORF Type: complete

Annotations of Ll_transcript_68000

• Blastp: Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 from Arabidopsis with 63.6% of identity
• Blastx: Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 from Arabidopsis with 61.54% of identity
• Eggnog: Zinc finger protein(COG5048)
• Kegg: Link to kegg annotations (AT1G34370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441972.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;