Protein coding transcript 1927

• Transcript: Ll_transcript_432232
• CDS coordinates: 67-585 (+)
• Peptide sequence: MKAKGELKEFEVIGRKIPTEKEKTTPLYKMRIFAPDAIVAKSRFWYFLRQLKKFKKSTGEIVSLKSIPEKTPLKIKNFGIWLRYDSRSGTHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQIIKVEVITNRKECRRALVKQFHNSKIRFPLPKRIQLKRRMPLFSLRKP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_432232

• Blastp: 60S ribosomal protein L18a from Spodoptera with 78.61% of identity
• Blastx: 60S ribosomal protein L18a from Spodoptera with 78.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014499801.1)
• Pfam: Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A (PF01775.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;