Transcript | Ll_transcript_22701 |
---|---|
CDS coordinates | 1-930 (+) |
Peptide sequence | AVDSSFRKLGIEKLSIGDVQRLEWEQLETKIRRWIRAAKVCVRTLFASEKRLCEQIFDGVGTCIDDACFMETVKGPAIQLFNFAEAISISRRSPEKLFKILDLHDALMNLMPDIDFVFDCKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLTRYVMNYISLISDYKVTLNELIVSKPSTGSRYSGDPSTPDMDFEEIEGQTPLAIHLIWIIVILQFNLDGKCKHYKDASLSHLFIMNNVHYIVQKVRGSAELREMIGDDYLRKLTGKFRQAATSYQRATWVGVLHCLRDDW* |
ORF Type | 5prime_partial |
Blastp | Exocyst complex component EXO70B1 from Arabidopsis with 41.69% of identity |
---|---|
Blastx | Exocyst complex component EXO70B1 from Arabidopsis with 41.69% of identity |
Eggnog | exocyst complex(ENOG410YIGI) |
Kegg | Link to kegg annotations (AT5G58430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430412.1) |
Pfam | Exo70 exocyst complex subunit (PF03081.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer