Protein coding transcript 1928

• Transcript: Ll_transcript_432261
• CDS coordinates: 3-446 (+)
• Peptide sequence: QHYHDQPQQFLQPDEGLCWIDTPLQSSKPSNDILTTLSEDNQRLRRKNYMLLSELTHMKNLYNDIIYFIQNHVNPAPFEQRSNIVIPKLVELDSLPQSPNVAAVIRPSKSGIMDKSLVNCSEDCNSSVKIFGVPLSGKKRVHSDNIG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_432261

• Blastp: Heat stress transcription factor B-4d from Oryza sativa with 40% of identity
• Blastx: Heat stress transcription factor B-4d from Oryza sativa with 40% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (107277264)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460439.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;