Protein coding transcript 192800

• Transcript: Ll_transcript_22704
• CDS coordinates: 1-930 (+)
• Peptide sequence: AVDSSFRKLGIEKLSIGDVQRLEWEQLETKIRRWIRAAKVCVRTLFASEKRLCEQIFDGVGTCIDDACFMETVKGPAIQLFNFAEAISISRRSPEKLFKILDLHDALMNLMPDIDFVFDCKSSDSIRVQAAEILSRLAEAARGILSEFENAVLREPSKVPVPGGTIHPLTRYVMNYISLISDYKVTLNELIVSKPSTGSRYSGDPSTPDMDFEEIEGQTPLAIHLIWIIVILQFNLDGKCKHYKDASLSHLFIMNNVHYIVQKVRGSAELREMIGDDYLRKLTGKFRQAATSYQRATWVGVLHCLRDDW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_22704

• Blastp: Exocyst complex component EXO70B1 from Arabidopsis with 41.69% of identity
• Blastx: Exocyst complex component EXO70B1 from Arabidopsis with 41.69% of identity
• Eggnog: exocyst complex(ENOG410YIGI)
• Kegg: Link to kegg annotations (AT5G58430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430412.1)
• Pfam: Exo70 exocyst complex subunit (PF03081.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;