Protein coding transcript 192827

• Transcript: Ll_transcript_22381
• CDS coordinates: 138-758 (+)
• Peptide sequence: MSNEYLNLKDERECSGKGKRLWKKVKYQLVEYHALPGYLRDNEYILAHYRSEWPMKQVLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMQVPKVVDLNSLQHLPDMLKNVDLHKLQSELLLCLPSLPDFHRLREELRTTIPSISSWHVKELLYNCLPERFFSENHTDISVLVIPGGKAVNVKLAFSFDMCYFTFCYVVDKFFLH*
• ORF Type: complete

Annotations of Ll_transcript_22381

• Blastp: Heptahelical transmembrane protein 5 from Arabidopsis with 70.89% of identity
• Blastx: Heptahelical transmembrane protein 4 from Arabidopsis with 84.02% of identity
• Eggnog: Channel protein (Hemolysin III family(COG1272)
• Kegg: Link to kegg annotations (AT4G38320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423825.1)
• Pfam: Haemolysin-III related (PF03006.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;