Transcript | Ll_transcript_22389 |
---|---|
CDS coordinates | 138-1076 (+) |
Peptide sequence | MSNEYLNLKDERECSGKGKRLWKKVKYQLVEYHALPGYLRDNEYILAHYRSEWPMKQVLLSIFTIHNETLNVWTHLIGFFLFLALTIYTAMQVPKHNVKEDLANLIAPLMIRPITRWPFFVFLGGAMFCLLASSTCHLLSCHSERLSYMMLRLDYAGIAALISTSFYPPVYYSFMCYPFFCNLYLGFITLLGIATMLVSLLPVFQTPEYRTIRASLFFGMGFSGAAPILHKLFLFWGEPEVFYTTGCEILMGAFYGIGALIYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAYTHYRAGLVYLRWRDLRGC* |
ORF Type | complete |
Blastp | Heptahelical transmembrane protein 4 from Arabidopsis with 67.67% of identity |
---|---|
Blastx | Heptahelical transmembrane protein 4 from Arabidopsis with 67.67% of identity |
Eggnog | Channel protein (Hemolysin III family(COG1272) |
Kegg | Link to kegg annotations (AT4G37680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423825.1) |
Pfam | Haemolysin-III related (PF03006.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer