Transcript | Ll_transcript_20873 |
---|---|
CDS coordinates | 798-1751 (+) |
Peptide sequence | MNRCCNSFSQFIGGFDTAHAAARAYDRAAIKFRGVDADINFNVSDYDEDIKQMGNFTKEEFVHILRRQSTGFSRGSSKYRGVTLHKCGRWEARMGQFLGKKYIYLGLFDSELEAARAYDMAAIKCNGREAVTNFEASSYEGEVISQADNEDSELILDLNLGIAPPSYDGQIKNMHNIESGLQVQRSWDDVPIDSRLMYEHSGPRSMMAQPSHGFSLASEHPPVWNGTNFLPICKERAIENRMEADPLANRAWQLQGPYGGAPLIPPFSAAASSGFPSTIIPSAAESRLHFPNMMFFNPHFPPSIPNSSTIPNFYCRS* |
ORF Type | complete |
Blastp | Floral homeotic protein APETALA 2 from Arabidopsis with 74.68% of identity |
---|---|
Blastx | Floral homeotic protein APETALA 2 from Arabidopsis with 74.68% of identity |
Eggnog | floral homeotic protein APETALA(ENOG410YBZ8) |
Kegg | Link to kegg annotations (AT4G36920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444368.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer