Protein coding transcript 192836

• Transcript: Ll_transcript_20884
• CDS coordinates: 1032-1628 (+)
• Peptide sequence: MAAIKCNGREAVTNFEASSYEGEVISQADNEDSELILDLNLGIAPPSYDGQIKNMHNIESGLQVQRSWDDVPIDSRLMYEHSGPRSMMAQPSHGFSLASEHPPVWNGTNFLPICKERAIENRMEADPLANRAWQLQGPYGGAPLIPPFSAAASSGFPSTIIPSAAESRLHFPNMMFFNPHFPPSIPNSSTIPNFYCRS*
• ORF Type: complete

Annotations of Ll_transcript_20884

• Blastp: Ethylene-responsive transcription factor RAP2-7 from Arabidopsis with 33.33% of identity
• Blastx: Floral homeotic protein APETALA 2 from Arabidopsis with 90.23% of identity
• Eggnog: Transcription factor(ENOG410YD13)
• Kegg: Link to kegg annotations (AT2G28550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444368.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;