Protein coding transcript 192893

• Transcript: Ll_transcript_21042
• CDS coordinates: 1197-1958 (+)
• Peptide sequence: MLLGFVLLGRSLEEKARIQASSDMNELLSLISTQSRLVITSSEGSSSSDNVLSSNSICVEVPTDDIRVGDSVLVLPGETIPIDGRIVSGRSVVDESMLTGESLPVFKEAGLTVSAGTINWDGPLRIEASSTGSNTMISKIVRMVEDAQSREAPVQRLADSIAGPFVYSVMTLSAATFAFWYFIGSNIFPDVLLNDIAGPEGNPLLLSLKLSVDVLVSDFKFMIKTTCLSLLAFLPLISRALTTPFFLPFRFCC*
• ORF Type: complete

Annotations of Ll_transcript_21042

• Blastp: Copper-transporting ATPase PAA2, chloroplastic from Arabidopsis with 79.17% of identity
• Blastx: Copper-transporting ATPase PAA2, chloroplastic from Arabidopsis with 78.26% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT5G21930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437831.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;