Transcript | Ll_transcript_432262 |
---|---|
CDS coordinates | 96-473 (+) |
Peptide sequence | MAFTLDRCEDNIVFTVDSQKSVPAPFLTKTYQLVDDPQTDNIVSWSDDETTFVVWRPSEFARDLLPNYFKHNNFSSFVRQLNTYGFKKVVADRWEFSNEYFRKGAKHLLCEIHRRKTPHHHQQHYH |
ORF Type | 3prime_partial |
Blastp | Heat stress transcription factor B-4b from Oryza sativa with 72.22% of identity |
---|---|
Blastx | Heat stress transcription factor B-4b from Oryza sativa with 72.22% of identity |
Eggnog | Transcription factor(COG5169) |
Kegg | Link to kegg annotations (4344063) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017429503.1) |
Pfam | HSF-type DNA-binding (PF00447.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer