Protein coding transcript 192902

• Transcript: Ll_transcript_22123
• CDS coordinates: 933-1268 (+)
• Peptide sequence: MEPEQVAMCIQLGLLCTQGDPQLRPNMRRVVMMLSRKPGHMDEPVRPGTPGSRYRRPRKHSAMSSTVDTSDSHTSDSSNNCTTRTTTATGTNSATNTIEIIDSKGKRPMQS*
• ORF Type: complete

Annotations of Ll_transcript_22123

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase SRK from Arabidopsis with 38.67% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 3 from Arabidopsis with 61.54% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464556.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;