Protein coding transcript 192904

• Transcript: Ll_transcript_22119
• CDS coordinates: 56-469 (+)
• Peptide sequence: MDKPHSFLHSLVKHFKFGSTTGQNNEADLQRMAAQEQKIFAYETLVVATKNFDATHKLGAGGFGPVYKGKLKDGREIAVKKLSQTSNQGKKEFLNEARLLARVQHRNVVNLLGYCVHGTENILVYEYVPHESLDKLLF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_22119

• Blastp: G-type lectin S-receptor-like serine/threonine-protein kinase At1g61400 from Arabidopsis with 54.05% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At1g61400 from Arabidopsis with 54.05% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G61400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464556.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;