Protein coding transcript 192916

• Transcript: Ll_transcript_20521
• CDS coordinates: 2-382 (+)
• Peptide sequence: WLYSIIFYFPLDVLKFIIRYVLSGKGWSNITENKIAFTTKKDYGKEEREAQWATAQRTLHGLNPPGTEQILQEHNTFSELSEIAEQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_20521

• Blastp: Plasma membrane ATPase 4 from Nicotiana with 77.78% of identity
• Blastx: Plasma membrane ATPase 4 from Nicotiana with 77.78% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001630)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427171.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;