Protein coding transcript 192917

• Transcript: Ll_transcript_20523
• CDS coordinates: 1-306 (+)
• Peptide sequence: NGVGWKWAGVLWIYSIVTYIPLDILKFFIRMGLTGSAWDNMLQNKTAFTTKKDYGKGEREAQWAVAQRTLHGLQVPDAHLNNSHEHSEIAEQAKKRAEAAR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_20523

• Blastp: ATPase 8, plasma membrane-type from Arabidopsis with 75.25% of identity
• Blastx: ATPase 8, plasma membrane-type from Arabidopsis with 73.86% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT3G42640)
• CantataDB: Link to cantataDB annotations (CNT0001630)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446103.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;