Protein coding transcript 192921

• Transcript: Ll_transcript_20530
• CDS coordinates: 3-494 (+)
• Peptide sequence: ENLNSALYLQVSIISQALIFVTRSRSWSYFERPGAMLCIAFLAAQLVATVIAVYAHWDFARINGVGWRWAGVIWIYSIVTYIPLDILKFFIRMGLSGSAWNSMLQNKTAFTTKKDYGRGDREAQWAVAQRTLHGLHVSDAHLNNQHEHSEIAEQAKKRAEAAR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_20530

• Blastp: ATPase 6, plasma membrane-type from Arabidopsis with 72.29% of identity
• Blastx: ATPase 6, plasma membrane-type from Arabidopsis with 70.2% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT2G07560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417373.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;