| Transcript | Ll_transcript_20532 |
|---|---|
| CDS coordinates | 1-324 (+) |
| Peptide sequence | VYFTPMLPVTNSRGAFYGGDGAMQFLKQLVAAFLVSTTIILLFIQLFIPLRMPEDQLEIGDDAVHGEEAYALWGDGEKYDPIRHGSLNIGHSPSPYVNGARGVTINL* |
| ORF Type | 5prime_partial |
| Blastp | Ammonium transporter 2 from Arabidopsis with 61.61% of identity |
|---|---|
| Blastx | Ammonium transporter 2 from Arabidopsis with 61.61% of identity |
| Eggnog | ammonium Transporter(COG0004) |
| Kegg | Link to kegg annotations (AT2G38290) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429701.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer