Protein coding transcript 19294

• Transcript: Ll_transcript_418916
• CDS coordinates: 1526-2725 (+)
• Peptide sequence: MTNERKYDLSPGDIAKQLNLISKVHGLEQAKKFFQGIPDAKIGFKVCAALLSCYAEHKSLDEAEAIMKKVKEYHPVHITVCYNMMLKLYAQVGKYEKLERLMQEMKDKDICNGASFTIRLNAYVAAADIEGMEKLLMWMEADPIATVDWYTYTTAANAYIKAGDFEKATAMLKKSEQLARGKTRRLAYESLQTMYAAIGNKDEVYRIWNRCKIFKSSYNSSSISMLSSLVKLDDIDGAENLVEEWESKCTHFDTRIPNLMITAYCKWGLLDKAEAYIKRLLDSGKKLDGSTWDRFAFTYRMGNDMDKAVKSMKKAISEDRPGWKPNPFTLVACIKYAKEKEELDLALELLSLCRKHGHISVATYDGLASYVHSEILDTKAFDLIKGDYQLDEKIQLLEG*
• ORF Type: complete

Annotations of Ll_transcript_418916

• Blastp: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial from Arabidopsis with 41.35% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial from Arabidopsis with 41.44% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G20710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429637.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;