Protein coding transcript 192954

• Transcript: Ll_transcript_21365
• CDS coordinates: 3-326 (+)
• Peptide sequence: VLLRNNATCNVIGIGTIRIKMFDGIVKTLTDVRHVPELKKNLISLGTLDSKGYSYKGEGGAIRVSKGAMVVMKGKRIISTCYKEAQSQVMLLYPQHLILMSQNYDIL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_21365

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.89% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00240 from Arabidopsis with 42.17% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442281.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;