Protein coding transcript 1930

• Transcript: Ll_transcript_432263
• CDS coordinates: 3-350 (+)
• Peptide sequence: PTINLLSFLSSKHFIQHFHSPSLDKHCLFLTDLYSIYSHSQTLSMDLVVDNSEGLLLSLDSHKSVPSPFLTKTYQLVDDPNTNHIVSWGQNDITFVVWRPPEFARDVLSNYFKHNN
• ORF Type: internal

Annotations of Ll_transcript_432263

• Blastp: Heat stress transcription factor B-4b from Oryza sativa with 83.33% of identity
• Blastx: Heat stress transcription factor B-4b from Oryza sativa with 83.33% of identity
• Eggnog: Transcription factor(COG5169)
• Kegg: Link to kegg annotations (4344063)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429815.1)
• Pfam: HSF-type DNA-binding (PF00447.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;