Protein coding transcript 193009

• Transcript: Ll_transcript_21531
• CDS coordinates: 1052-1873 (+)
• Peptide sequence: MGFSVSLGLLAGSVSSYEFVSPRKEIQWLASVFTGIIFCVIVYRLMAIFSSLLFAGYSKLTNTQKIEWNNRGFSTFHALFASFASIYLLIFSNIFKEDSHEELVINRSSTLSDSVLAISTGYFLADVTMILWNFPALGGLEYVLHHGLSMLSLIQSLLSGQGQIYILMVLFTESTTPFVNLRWHLDVAGRKSSKLYIWNGIALFLGWLVARIILFMFFFFHMWTHFDEVKKIFPLGFYTLLVVPPILSIMNIFWFWKIAKGMVKTLSKAKHSK*
• ORF Type: complete

Annotations of Ll_transcript_21531

• Blastp: Transmembrane protein 56-B from Xenopus with 28.83% of identity
• Blastx: Transmembrane protein 56-B from Xenopus with 28.83% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (379606)
• CantataDB: Link to cantataDB annotations (CNT0000251)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419997.1)
• Pfam: TLC domain (PF03798.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;