Protein coding transcript 193032

• Transcript: Ll_transcript_21561
• CDS coordinates: 84-617 (+)
• Peptide sequence: MVREVSESCLDSLMREMIDSYCNRFYADKPDLAARRIEAIGYQVGHQLSERYTIDRPRFNDHLEAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNKFLWLARMSIDPSSADNVNSAEDHSSPSAENIAAHAMSMHLYFPCGIIRGALSNLGIPCAVSADISNLPACSFVIRIKA*
• ORF Type: complete

Annotations of Ll_transcript_21561

• Blastp: Trafficking protein particle complex subunit 6B from Homo with 47.52% of identity
• Blastx: Trafficking protein particle complex subunit 6B from Homo with 47.52% of identity
• Eggnog: trafficking protein particle complex(ENOG410YUYH)
• Kegg: Link to kegg annotations (122553)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418166.1)
• Pfam: Transport protein particle (TRAPP) component (PF04051.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;