Transcript | Ll_transcript_21003 |
---|---|
CDS coordinates | 591-962 (+) |
Peptide sequence | MGFQFILFLFLASLRVGVTLNQDVAHGSLQVHGTEAKAETGDNFICATIDWWPHDKCDYSHCPWGYSSVVNLDLTHPFLAKAIQGLYVCITQVHMIYKIQLLNSHRKMLQCLFFMNVIIYGME* |
ORF Type | complete |
Blastp | Heparanase-like protein 1 from Arabidopsis with 49.43% of identity |
---|---|
Blastx | Heparanase-like protein 2 from Arabidopsis with 63.29% of identity |
Eggnog | Heparanase(ENOG410YDJW) |
Kegg | Link to kegg annotations (AT5G07830) |
CantataDB | Link to cantataDB annotations (CNT0000518) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417534.1) |
Pfam | Glycosyl hydrolase family 79, N-terminal domain (PF03662.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer