Protein coding transcript 193064

• Transcript: Ll_transcript_21004
• CDS coordinates: 591-1031 (+)
• Peptide sequence: MGFQFILFLFLASLRVGVTLNQDVAHGSLQVHGTEAKAETGDNFICATIDWWPHDKCDYSHCPWGYSSVVNLDLTHPFLAKAIQALKPLRIRLGGSLQDQVIYDVGSLGSPCHPFQKMKDGLFGFSKGCLHMKRWDELHHFFNETG*
• ORF Type: complete

Annotations of Ll_transcript_21004

• Blastp: Heparanase-like protein 1 from Arabidopsis with 61.74% of identity
• Blastx: Heparanase-like protein 1 from Arabidopsis with 61.74% of identity
• Eggnog: Heparanase(ENOG410YDJW)
• Kegg: Link to kegg annotations (AT5G07830)
• CantataDB: Link to cantataDB annotations (CNT0000518)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417534.1)
• Pfam: Glycosyl hydrolase family 79, N-terminal domain (PF03662.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;