Transcript | Ll_transcript_21012 |
---|---|
CDS coordinates | 795-1163 (+) |
Peptide sequence | MGFRLALILFLASIHLTLCQDVEHGLILVDGTEALAETDDNFICATIDWWPHDKCDYNYCPWGYSSVTNLDLSHPFLANAIQALKPLRIRIGGSLQDQVQYEVGSLKSPCHSFQKMKGGLFGY |
ORF Type | 3prime_partial |
Blastp | Heparanase-like protein 1 from Arabidopsis with 57.81% of identity |
---|---|
Blastx | Heparanase-like protein 1 from Arabidopsis with 57.81% of identity |
Eggnog | Heparanase(ENOG410YDJW) |
Kegg | Link to kegg annotations (AT5G07830) |
CantataDB | Link to cantataDB annotations (CNT0000532) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438746.1) |
Pfam | Glycosyl hydrolase family 79, N-terminal domain (PF03662.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer