Transcript | Ll_transcript_20814 |
---|---|
CDS coordinates | 977-1438 (+) |
Peptide sequence | MHMVSLTFFICLWYREPRGFGFVQYLDPDDAADAKYQMDGQIFLGRELTVVFAEENRKKPAEMRARERGRSYDYRRSPRRYSRSPRYGQYSRSPDYSPSPRGRHYSRSISPRDRRYRGRSYSRSPYGSRSRSRSRSYRRGYSRSLSRSPGYSR* |
ORF Type | complete |
Blastp | Serine/arginine-rich SC35-like splicing factor SCL30A from Arabidopsis with 54.86% of identity |
---|---|
Blastx | Serine/arginine-rich SC35-like splicing factor SCL30A from Arabidopsis with 75% of identity |
Eggnog | serine arginine-rich splicing factor(ENOG4111J16) |
Kegg | Link to kegg annotations (AT3G13570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428894.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer